DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Phox2b

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_008768389.3 Gene:Phox2b / 364152 RGDID:1560582 Length:314 Species:Rattus norvegicus


Alignment Length:180 Identity:77/180 - (42%)
Similarity:98/180 - (54%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YNLMIDSSYKLC---------ANESAIRGSLNQESSLLFSKITTV-------SEFYPATHNIGSY 90
            |:.:..|:|:.|         |:..|...|.:|.|...::.|.|.       ....|.:.::|:.
  Rat     6 YSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL 70

  Fly    91 NTDFH---------LKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIA 146
            ..  |         .|.:.|.| .|.:|.|||||||||||.||.|||::|.||||||||||||:|
  Rat    71 RD--HQSSPYAAVPYKLFTDHG-GLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELA 132

  Fly   147 SKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSK 196
            .|:.||||||||||||||||||||||.|       ::.....||..:|.|
  Rat   133 LKIDLTEARVQVWFQNRRAKFRKQERAA-------AAAAAAAKNGSSGKK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
Phox2bXP_008768389.3 Homeobox 102..155 CDD:395001 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6693
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm44846
orthoMCL 1 0.900 - - OOG6_109475
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.