DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Rhox12

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001020072.1 Gene:Rhox12 / 363437 RGDID:1563789 Length:175 Species:Rattus norvegicus


Alignment Length:154 Identity:48/154 - (31%)
Similarity:71/154 - (46%) Gaps:29/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SSYKLCANESAI--------------RGSLNQESSLLFSKITTVSE--FYPATHNIGSYNTDFHL 96
            |||||..||..:              .||||....|.:..|....:  :......||:...|.:.
  Rat    11 SSYKLEENEIEVSLDADEAAEGGSFGEGSLNGSDKLKYEGIPDKDDRIYVGDVKYIGNDVKDEYR 75

  Fly    97 KSYGDDGLSLTDKSK-------------QRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASK 148
            .|:...|.|..::.|             :.||:...|..||:|||..|..|.|||:.||..:|..
  Rat    76 GSHQGSGDSQLEEQKNLASPTIPQFRRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKH 140

  Fly   149 LHLTEARVQVWFQNRRAKFRKQER 172
            |:|.|:||:.||:.|||::||:::
  Rat   141 LYLAESRVKRWFKRRRARYRKEQQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 24/51 (47%)
Rhox12NP_001020072.1 homeodomain 101..163 CDD:238039 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.