DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and otx5

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_851848.2 Gene:otx5 / 353179 ZFINID:ZDB-GENE-030508-1 Length:289 Species:Danio rerio


Alignment Length:128 Identity:51/128 - (39%)
Similarity:68/128 - (53%) Gaps:28/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SYNTDFHLKSYGDDGLSLTDKS---------------KQRRIRTTFTSNQLNELEKIFLETHYPD 138
            ||....|   |..:||:||...               ||||.|||||..||:.||.:|.:|.|||
Zfish     3 SYMKQPH---YSVNGLTLTGTGMDLLHSAVGYPNTPRKQRRERTTFTRAQLDVLEALFSKTRYPD 64

  Fly   139 IYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSKYLGPS 201
            |:.|||:|.|::|.|:||||||:|||||.|:|::          .:..|:..|....|...|:
Zfish    65 IFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ----------QQTSGQTKPRPPKKKSSPA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
otx5NP_851848.2 Homeodomain 39..94 CDD:459649 35/54 (65%)
TF_Otx 157..231 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.