DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and prd

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:86 Identity:47/86 - (54%)
Similarity:62/86 - (72%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKL 149
            ||.|..:.:.......:.|::|  |.||||.||||:::||:|||:.|..|.|||||||||:|.:.
  Fly   188 HNNGKPSDEDISDCESEPGIAL--KRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRT 250

  Fly   150 HLTEARVQVWFQNRRAKFRKQ 170
            :|||||:||||.||||:.|||
  Fly   251 NLTEARIQVWFSNRRARLRKQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 36/55 (65%)
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.