DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and VSX2

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_878314.1 Gene:VSX2 / 338917 HGNCID:1975 Length:361 Species:Homo sapiens


Alignment Length:105 Identity:52/105 - (49%)
Similarity:63/105 - (60%) Gaps:22/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFR 168
            |:.|.|.|:||.||.|||.||.||||.|.|.||||:|.||.:|.|..|.|.|:||||||||||:|
Human   140 LNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWR 204

  Fly   169 KQE-------------------RHAIYIMKD--KSSKLDG 187
            |:|                   ||:|.:.:.  ||:| ||
Human   205 KREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAK-DG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 35/51 (69%)
VSX2NP_878314.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..151 5/10 (50%)
Homeobox 153..205 CDD:395001 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..300
OAR 300..318 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..361
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.