DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Gsc

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:77/145 - (53%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 YPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEI 145
            :|...::|:::...|..|:...|   ....::||.||.||..||.:||..|.:|||||:..||::
  Fly   312 HPHHPHLGAHHHGQHHLSHLGHG---PPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQL 373

  Fly   146 ASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKL---------DGRKNPVAGSKYLGPS 201
            |.|:.|.|.||:|||:|||||:|||:|..    :::..||         :|..|..:|:.     
  Fly   374 ALKVDLKEERVEVWFKNRRAKWRKQKREE----QERLRKLQEEQCGSTTNGTTNSSSGTT----- 429

  Fly   202 LKGPQNGHGR-QMKC 215
               ...|:|. .:||
  Fly   430 ---SSTGNGSLTVKC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 30/51 (59%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.