DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Vsx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:90 Identity:43/90 - (47%)
Similarity:56/90 - (62%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NTDFHLKSYGDD--------GLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            |.:..|.::|.|        |.....|:|:|..||.|||:||.||||.|.|.||||:..||.::.
  Fly   366 NPNSLLAAHGGDVLVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSM 430

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQER 172
            |..|.|.|:|||:||||||:||.|:
  Fly   431 KTGLAEDRIQVWYQNRRAKWRKTEK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 32/51 (63%)
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 1 0.900 - - E1_KOG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.