DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PHDP and VSX1

DIOPT Version :9

Sequence 1:	NP_523834.1	Gene:	PHDP / 37788	FlyBaseID:	FBgn0025334	Length:	220	Species:	Drosophila melanogaster
Sequence 2:	NP_055403.2	Gene:	VSX1 / 30813	HGNCID:	12723	Length:	365	Species:	Homo sapiens

Alignment Length:	64	Identity:	41/64 - (64%)
Similarity:	50/64 - (78%)	Gaps:	0/64 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   109 KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER 172
            |.|:||.||.||::||.||||.|.|.||||:|.||.:|.|..|.|.|:||||||||||:||:|:
Human   161 KRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREK 224

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PHDP	NP_523834.1	Homeobox	116..168	CDD:278475	34/51 (67%)
VSX1	NP_055403.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..37
		Octapeptide motif	31..38
		DNA_pol3_delta2	<47..>149	CDD:331068
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..167		3/5 (60%)
		Nuclear localization signal. /evidence=ECO:0000255	161..166		2/4 (50%)
		Homeobox	167..220	CDD:306543	34/52 (65%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	290..365
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0494
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810