DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and pax7a

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_571400.1 Gene:pax7a / 30587 ZFINID:ZDB-GENE-990415-201 Length:507 Species:Danio rerio


Alignment Length:74 Identity:50/74 - (67%)
Similarity:55/74 - (74%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GDDGLSLTD---KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQ 161
            |.|..|..|   |.||||.|||||:.||.||||.|..|||||||||||:|.:..||||||||||.
Zfish   205 GSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFS 269

  Fly   162 NRRAKFRKQ 170
            ||||::|||
Zfish   270 NRRARWRKQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 40/55 (73%)
pax7aNP_571400.1 PAX 34..166 CDD:238076
Homeodomain 221..277 CDD:459649 40/55 (73%)
Pax7 343..386 CDD:403540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.