DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and otx2b

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_571326.1 Gene:otx2b / 30501 ZFINID:ZDB-GENE-980526-406 Length:289 Species:Danio rerio


Alignment Length:119 Identity:51/119 - (42%)
Similarity:69/119 - (57%) Gaps:27/119 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HLKS--YGDDGLSLTDKS---------------KQRRIRTTFTSNQLNELEKIFLETHYPDIYTR 142
            :||.  |..:|||||...               ||||.|||||..||:.||.:|.:|.||||:.|
Zfish     4 YLKQPPYTVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMR 68

  Fly   143 EEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSK 196
            ||:|.|::|.|:||||||:|||||.|:|::          .:.:|.:|.|..:|
Zfish    69 EEVALKINLPESRVQVWFKNRRAKCRQQQQ----------QQQNGGQNKVRPAK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
otx2bNP_571326.1 Homeodomain 39..94 CDD:459649 35/54 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..142 6/30 (20%)
TF_Otx 153..234 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.