DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and dharma

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:71 Identity:32/71 - (45%)
Similarity:47/71 - (66%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQ----ERHA 174
            ||||.||.||..:||::|..|.||.:.||.|:|....|:|..|:|||:||||:.::|    ::||
Zfish   117 RIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTGLSEETVRVWFKNRRARRKRQTTCADKHA 181

  Fly   175 IYIMKD 180
            ...::|
Zfish   182 NRALED 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 26/51 (51%)
dharmaNP_571054.1 Homeobox 119..171 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.