DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Pitx3

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_062120.1 Gene:Pitx3 / 29609 RGDID:3332 Length:302 Species:Rattus norvegicus


Alignment Length:72 Identity:47/72 - (65%)
Similarity:54/72 - (75%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA 165
            :|| ||  |.||||.||.|||.||.|||..|....|||:.||||||...:||||||:|||:||||
  Rat    54 EDG-SL--KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRA 115

  Fly   166 KFRKQER 172
            |:||:||
  Rat   116 KWRKRER 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 36/55 (65%)
Pitx3NP_062120.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 12/19 (63%)
Homeodomain 63..119 CDD:459649 36/55 (65%)
PTZ00395 <142..>236 CDD:185594
OAR 258..275 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275
Nuclear localization signal. /evidence=ECO:0000255 268..272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.