DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and sebox

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:133 Identity:44/133 - (33%)
Similarity:70/133 - (52%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LMIDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPAT--HNIGSYNTD--FHLKSYGDDGL 104
            |..|.|:.|...:..   ::..||..:|:  |.:.:|...|  |.:.|...|  .|:        
Zfish     3 LFYDQSFDLGLVQKI---NMETESDFIFN--TNMLQFTDVTTKHMLSSPELDRTGHV-------- 54

  Fly   105 SLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRK 169
                :.:::|.||.|:..||:|||:.|:.|.||||..||.:|:...|.|:::|||||||||:..|
Zfish    55 ----EGQRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMK 115

  Fly   170 QER 172
            .::
Zfish   116 SKK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 28/51 (55%)
seboxNP_001306981.1 COG5576 13..159 CDD:227863 40/123 (33%)
Homeobox 61..112 CDD:278475 27/50 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.