DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and ALX3

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:91 Identity:50/91 - (54%)
Similarity:66/91 - (72%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DGLSLT-DKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA 165
            |.:.|. :|||:||.||||::.||.||||:|.:|||||:|.||::|.:..|||||||||||||||
Human   142 DSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRA 206

  Fly   166 KFRKQERHAIYIMKDKSSKLDGRKNP 191
            |:||:||:         .|:...:||
Human   207 KWRKRERY---------GKIQEGRNP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 36/51 (71%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
PRK12323 <13..131 CDD:237057
Homeobox 157..210 CDD:365835 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.