DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Drgx

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:111 Identity:59/111 - (53%)
Similarity:73/111 - (65%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNT-DFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            |...|:::| ||      |||..   :.||||.|||||..||..||.:|.:|||||::||||:|.
  Rat    13 TAPFGNHSTGDF------DDGFL---RRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAM 68

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVA 193
            |::||||||||||||||||:||.||.|       |.:..|.|.|:|
  Rat    69 KINLTEARVQVWFQNRRAKWRKTERGA-------SDQEPGAKEPMA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 39/55 (71%)
DrgxNP_665710.2 Homeodomain 34..90 CDD:459649 39/55 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 10/27 (37%)
OAR 201..218 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.