DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Drgx

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:111 Identity:59/111 - (53%)
Similarity:73/111 - (65%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNT-DFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            |...|:::| ||      |||..   :.||||.|||||..||..||.:|.:|||||::||||:|.
  Rat    13 TAPFGNHSTGDF------DDGFL---RRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAM 68

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVA 193
            |::||||||||||||||||:||.||.|       |.:..|.|.|:|
  Rat    69 KINLTEARVQVWFQNRRAKWRKTERGA-------SDQEPGAKEPMA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 37/51 (73%)
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 10/27 (37%)
OAR 201..218 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.