DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Alx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_766141.1 Gene:Alx1 / 216285 MGIID:104621 Length:326 Species:Mus musculus


Alignment Length:183 Identity:73/183 - (39%)
Similarity:92/183 - (50%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSEFYNSGANG------GGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKITTV- 77
            |..||.....|      |.|..|.|    ::.:|            |.|..|:||:.:. ||.| 
Mouse    37 NESFYGKATAGKCVQAFGPLPRAEH----HVRLD------------RTSPCQDSSVNYG-ITKVE 84

  Fly    78 -----SEFYPATHNIGSYNTD--------FHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEK 129
                 :|...|..|..:....        ..|...||...|....||:||.||||||.||.||||
Mouse    85 GQPLHTELNRAMDNCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEK 149

  Fly   130 IFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKS 182
            :|.:|||||:|.||::|.:..||||||||||||||||:||:||:. .|.:.||
Mouse   150 VFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYG-QIQQAKS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 38/51 (75%)
Alx1NP_766141.1 Homeobox 135..189 CDD:395001 38/53 (72%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 4/11 (36%)
OAR 302..320 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.