DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and pax-3

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_496189.2 Gene:pax-3 / 185022 WormBaseID:WBGene00003939 Length:308 Species:Caenorhabditis elegans


Alignment Length:91 Identity:36/91 - (39%)
Similarity:49/91 - (53%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SYNTDFHL--------KSYGDD--GLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTRE 143
            ||:.|..|        ||..||  |.|.::.:..||.||:||:.||:.||..|....||....||
 Worm   154 SYSIDSILGISIDECSKSSSDDEEGSSPSNDASSRRNRTSFTAEQLDVLENAFRADTYPHANARE 218

  Fly   144 EIASKLHLTEARVQVWFQNRRAKFRK 169
            .|:.:..|:|.::..||.||||:.||
 Worm   219 SISKETGLSEEKIMTWFSNRRARCRK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 24/55 (44%)
pax-3NP_496189.2 PAX 13..141 CDD:238076
Homeodomain 188..244 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.