DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Otx1

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_035153.1 Gene:Otx1 / 18423 MGIID:97450 Length:355 Species:Mus musculus


Alignment Length:129 Identity:51/129 - (39%)
Similarity:74/129 - (57%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HLKS--YGDDGLSLTDKS---------------KQRRIRTTFTSNQLNELEKIFLETHYPDIYTR 142
            :||.  ||.:||.|...:               ||||.|||||.:||:.||.:|.:|.||||:.|
Mouse     4 YLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMR 68

  Fly   143 EEIASKLHLTEARVQVWFQNRRAKFRKQERHA----IYIMKDKSSKLDGRKNPVAGSKYLGPSL 202
            ||:|.|::|.|:||||||:|||||.|:|::..    ...:|.|||.:.......:..::..|::
Mouse    69 EEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTKTRPVKKKSSPVRESSGSESSGQFTPPAV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
Otx1NP_035153.1 Homeodomain 39..95 CDD:459649 35/55 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..144 9/42 (21%)
TF_Otx 178..274 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.