powered by:
Protein Alignment PHDP and ceh-53
DIOPT Version :9
Sequence 1: | NP_523834.1 |
Gene: | PHDP / 37788 |
FlyBaseID: | FBgn0025334 |
Length: | 220 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500361.3 |
Gene: | ceh-53 / 182467 |
WormBaseID: | WBGene00015651 |
Length: | 203 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 33/67 - (49%) |
Similarity: | 49/67 - (73%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 TDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQE 171
:::.:.||:||.|:.|||..||:.||:..|||:..||.:..:..|.|||:||||:|||||.||::
Worm 26 SEERRVRRLRTAFSENQLELLEEAFLKCQYPDVQQRETLGKQTELAEARIQVWFKNRRAKARKRQ 90
Fly 172 RH 173
|:
Worm 91 RN 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.