DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and ceh-53

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:67 Identity:33/67 - (49%)
Similarity:49/67 - (73%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQE 171
            :::.:.||:||.|:.|||..||:.||:..|||:..||.:..:..|.|||:||||:|||||.||::
 Worm    26 SEERRVRRLRTAFSENQLELLEEAFLKCQYPDVQQRETLGKQTELAEARIQVWFKNRRAKARKRQ 90

  Fly   172 RH 173
            |:
 Worm    91 RN 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 28/51 (55%)
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 23/45 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.