DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and alr-1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:206 Identity:70/206 - (33%)
Similarity:100/206 - (48%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EFSLLNKANFDKDC--LYTANSEFYNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLN 64
            |.|..::.:.|.:|  |:..|      ||:         :|.|:                :..:.
 Worm     7 EDSSKDEKDLDMNCPPLHRPN------GAD---------LNQYS----------------KSLME 40

  Fly    65 QESSLLFSKITTVSEFYPATHNIGSYNTDFH-LKS-------YGD------------------DG 103
            |..:.||:........:|...:|.:...:.| ||.       .||                  ||
 Worm    41 QLQAQLFANPALQFPSFPPAFSIAALTNNQHELKEDDGKKTPTGDNILEAASVLDNRENGSPSDG 105

  Fly   104 LSLTD---KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA 165
            .:..|   |.||||.||||::.||:||||:|..|||||::||||:|:::.|||||||||||||||
 Worm   106 TNSPDDNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRA 170

  Fly   166 KFRKQERHAIY 176
            |:|||||.:.:
 Worm   171 KYRKQERSSTH 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 37/51 (73%)
alr-1NP_509860.1 Homeobox 121..174 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.