DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and ceh-51

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:83 Identity:24/83 - (28%)
Similarity:46/83 - (55%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAI 175
            |:|..||.|:.:||..|...|.:.....:..|.::.:.:.|:..::::||||||.|.||::...|
 Worm   146 KRRGARTPFSDSQLYALRTRFEQCDTIKVDERRKLGAVIGLSPEQIKIWFQNRRFKLRKEKYKQI 210

  Fly   176 ---YIMKDKSSKLDGRKN 190
               .:.:.||:|.:..::
 Worm   211 KQDAVQQQKSAKEEAEED 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 16/51 (31%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.