DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and ceh-10

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_498251.1 Gene:ceh-10 / 175811 WormBaseID:WBGene00000435 Length:344 Species:Caenorhabditis elegans


Alignment Length:130 Identity:56/130 - (43%)
Similarity:73/130 - (56%) Gaps:12/130 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KLCANESAIRGSLNQESSLLFSKITTVSEFY---PATH----NIGSYNTDFHLKSYGDD-GLSLT 107
            :||..:|.  |  |..:.|::....:.||..   |.||    :|.|..|..:....|.. |....
 Worm    71 QLCGTDSI--G--NAPAPLMYRMPISTSEVITSEPQTHVSSSSILSSATTSNSSGGGSSGGGGKA 131

  Fly   108 DKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER 172
            .|.|:||.||.||..|::||||.|.::||||||.||.:|.|..|.|.|:||||||||||:||.|:
 Worm   132 SKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTEK 196

  Fly   173  172
             Worm   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 33/51 (65%)
ceh-10NP_498251.1 Homeobox 139..192 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.