DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and unc-4

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_496138.1 Gene:unc-4 / 174544 WormBaseID:WBGene00006744 Length:252 Species:Caenorhabditis elegans


Alignment Length:145 Identity:57/145 - (39%)
Similarity:83/145 - (57%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SKITTV-------SEFYPATHNIGSYNT--------DFHLKSYGDDGLSLTD-------KSKQRR 114
            |:|.:|       ||.|.|:.|..|.::        |.:|....|||::|.|       .:|:||
 Worm    26 SQINSVLLNPSDGSETYLASDNGKSTSSREQSTSPDDDNLLMNEDDGIALEDDNDTGESAAKRRR 90

  Fly   115 IRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERH---AIY 176
            .||.|:..||.|||..|..:||||::.||.:|.:|.|.|:||||||||||||:||:|::   :..
 Worm    91 TRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRNGSSE 155

  Fly   177 IMKDKSSKLDGRKNP 191
            |.||...:::.:..|
 Worm   156 IKKDDGEQMETKALP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 31/51 (61%)
unc-4NP_496138.1 COG5576 <79..186 CDD:227863 41/92 (45%)
Homeobox 91..144 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.