DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and ceh-17

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:171 Identity:75/171 - (43%)
Similarity:103/171 - (60%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYTANSEFYNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKI-----T 75
            |.||::.  :|.:.|...|.::..::|......|.:...| :.::..|.|:|.|:.|..     :
 Worm    57 LTTAHNT--SSSSAGNSTSSSSSSSNYRNTTHDSLQAFFN-TGLQYQLYQKSQLIGSDTIQRTSS 118

  Fly    76 TVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIY 140
            .|....|.:..:|:      |.|.|...|:..::.|||||||||||.||.|||:.|.||||||||
 Worm   119 NVLNGLPRSSLVGA------LCSTGGAPLNPAERRKQRRIRTTFTSGQLKELERSFCETHYPDIY 177

  Fly   141 TREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDK 181
            ||||||.::.||||||||||||||||:||||:  |..:||:
 Worm   178 TREEIAMRIDLTEARVQVWFQNRRAKYRKQEK--IRRVKDE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
ceh-17NP_491393.1 DLL_N 20..112 CDD:403572 14/57 (25%)
Homeobox 153..206 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I4432
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I3434
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto17377
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.