DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Emx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:188 Identity:52/188 - (27%)
Similarity:88/188 - (46%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SEFYNSGANGGGLSV--------ANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKITTV 77
            |.|..:.|.|.|.|:        ...:||..|.:..:::|.::      ||....|...::....
Mouse    64 SGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGSS------SLQPPHSFFSAQHRDP 122

  Fly    78 SEFYPATHNIGSYNTDFHLKSYGDDGLSLTD--KSKQRRIRTTFTSNQLNELEKIFLETHYPDIY 140
            ..|||.......:...|.......|||.|..  ..|.:||||.|:.:||..||:.|.:.||....
Mouse   123 LHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGA 187

  Fly   141 TREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSKYL 198
            .|:::|..|.|:|.:|:|||||||.|:::|:      ::::..:.:.:|.   ||.::
Mouse   188 ERKQLAGSLSLSETQVKVWFQNRRTKYKRQK------LEEEGPESEQKKK---GSHHI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 24/51 (47%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 37/109 (34%)
Homeobox 163..215 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.