DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Phox2a

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_446321.2 Gene:Phox2a / 116648 RGDID:621323 Length:281 Species:Rattus norvegicus


Alignment Length:177 Identity:73/177 - (41%)
Similarity:95/177 - (53%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFSLLNKANFDKDCLYTANSEFYNS-GA--NGGGLSVANHINHYNLMIDSSYKLCANESAIRGS 62
            |::|.||  ::| .|:....:..|.. ||  ..||...:        .:..::..........||
  Rat     1 MDYSYLN--SYD-SCVAAMEASAYGDFGACSQPGGFQYS--------PLRPAFPAAGPPCPALGS 54

  Fly    63 LNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNEL 127
            .|       ..:..:.:..||.::...|       .:..:...|.:|.|||||||||||.||.||
  Rat    55 SN-------CALGALRDHQPAPYSAVPY-------KFFPEPSGLHEKRKQRRIRTTFTSAQLKEL 105

  Fly   128 EKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHA 174
            |::|.||||||||||||:|.|:.||||||||||||||||||||||.|
  Rat   106 ERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
Phox2aNP_446321.2 Homeobox 94..147 CDD:395001 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..219 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6693
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm44846
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.