DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Vsx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_473409.1 Gene:Vsx1 / 114889 MGIID:1890816 Length:363 Species:Mus musculus


Alignment Length:90 Identity:45/90 - (50%)
Similarity:62/90 - (68%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNTDFHLKSYGDDGLSL-TDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            :.::.:.:.|...:...|..:|| ..|.|:||.||.||::||.||||.|.|.||||:|.||.:|:
Mouse   142 SESVSTSDGDSPSEEKNDPKMSLILGKRKKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAA 206

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQER 172
            |..|.|.|:||||||||||:||:|:
Mouse   207 KTELPEDRIQVWFQNRRAKWRKREK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
Vsx1NP_473409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Octapeptide motif 31..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..166 4/23 (17%)
Nuclear localization signal. /evidence=ECO:0000255 168..173 2/4 (50%)
Homeobox 174..227 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.