DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Vsx1

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_473409.1 Gene:Vsx1 / 114889 MGIID:1890816 Length:363 Species:Mus musculus


Alignment Length:90 Identity:45/90 - (50%)
Similarity:62/90 - (68%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNTDFHLKSYGDDGLSL-TDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            :.::.:.:.|...:...|..:|| ..|.|:||.||.||::||.||||.|.|.||||:|.||.:|:
Mouse   142 SESVSTSDGDSPSEEKNDPKMSLILGKRKKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAA 206

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQER 172
            |..|.|.|:||||||||||:||:|:
Mouse   207 KTELPEDRIQVWFQNRRAKWRKREK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 36/55 (65%)
Vsx1NP_473409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Octapeptide motif 31..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..166 4/23 (17%)
Nuclear localization signal. /evidence=ECO:0000255 168..173 2/4 (50%)
Homeodomain 172..228 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.