DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and drgx

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:145 Identity:65/145 - (44%)
Similarity:85/145 - (58%) Gaps:15/145 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FY---PATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYT 141
            ||   |....:||.....|..|..|||..   :.||||.|||||..||..||.:|.:|||||::|
 Frog     2 FYFHCPPQLEVGSPPFGAHAASEFDDGFL---RRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFT 63

  Fly   142 REEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSKYLGPS----- 201
            |||:|.|::||||||||||||||||:||.||.:   .:.:.:|....:...|| :.|.||     
 Frog    64 REELAMKINLTEARVQVWFQNRRAKWRKTERGS---CEQEGAKESAPEVTTAG-RNLSPSSTVEP 124

  Fly   202 LKGPQNGHGRQMKCL 216
            ::|.:.....|.:||
 Frog   125 VRGKKETLEAQQRCL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 37/51 (73%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 37/52 (71%)
OAR 204..220 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.