DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and nkx6-3

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_002932753.1 Gene:nkx6-3 / 100489301 XenbaseID:XB-GENE-478609 Length:255 Species:Xenopus tropicalis


Alignment Length:119 Identity:40/119 - (33%)
Similarity:62/119 - (52%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDD----GLSLTD-KSKQRRIR 116
            |::.||...|...:.:|..|     |.|:......||......|.:    .:|.|: .|:::..|
 Frog    79 SSVPGSCYGEQGSILTKSGT-----PYTNQSRGCWTDIEQDWRGGNRALSSVSNTEGSSRKKHTR 138

  Fly   117 TTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQ 170
            .|||.:|:..|||.|.:|.|.....|..:|..|.::|::|:|||||||.|:||:
 Frog   139 PTFTGHQIFALEKTFEQTKYLAGPERARLAFSLGMSESQVKVWFQNRRTKWRKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 24/51 (47%)
nkx6-3XP_002932753.1 Homeobox 137..190 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.