DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and phox2a

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001239128.1 Gene:phox2a / 100486496 XenbaseID:XB-GENE-853857 Length:281 Species:Xenopus tropicalis


Alignment Length:222 Identity:83/222 - (37%)
Similarity:112/222 - (50%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFSLLNKANFDKDCLYTANSEFYNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQ 65
            |::|.||  ::| .|:....:..|   |:....|..|.. .||              .||||...
 Frog     4 MDYSYLN--SYD-SCMAAMEASAY---ADFSSCSQPNSF-QYN--------------PIRGSFGA 47

  Fly    66 ESSLLFSKITTVS-------EFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQ 123
            ..:.  ..:||.:       :..|:.::...|       .:..|...:.:|.|||||||||||:|
 Frog    48 NPAC--PPLTTANCTLGALRDHQPSPYSTVPY-------KFFSDPSGINEKRKQRRIRTTFTSSQ 103

  Fly   124 LNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGR 188
            |.|||::|.||||||||||||:|.|:.||||||||||||||||||||||.|       :||....
 Frog   104 LKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA-------NSKSGSS 161

  Fly   189 KNPVAGSKYLGPSLKGPQNGHGRQMKC 215
            .|..:|:|...|. ...::...::..|
 Frog   162 NNGGSGNKKSDPR-SSSEDDESKESNC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
phox2aNP_001239128.1 Homeobox 96..148 CDD:278475 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6718
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm47890
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.