DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and shox2

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:145 Identity:60/145 - (41%)
Similarity:79/145 - (54%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYN 91
            |..|||....:.:...:|.::.     ..||   ||         .|:|.||.      .|....
 Frog    61 GGGGGGGGARSPVLELDLSVER-----IRES---GS---------PKLTEVSP------EIKERK 102

  Fly    92 TDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARV 156
            .:...::..::|.:   |.||||.||.||..||||||::|.||||||.:.|||::.:|.|:||||
 Frog   103 EELKQQALEEEGQT---KIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARV 164

  Fly   157 QVWFQNRRAKFRKQE 171
            ||||||||||.||||
 Frog   165 QVWFQNRRAKCRKQE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 38/55 (69%)
shox2NP_001093694.1 Homeodomain 121..177 CDD:459649 38/55 (69%)
OAR 292..307 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.