DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and vsx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001093670.1 Gene:vsx1 / 100101658 XenbaseID:XB-GENE-853166 Length:344 Species:Xenopus tropicalis


Alignment Length:212 Identity:74/212 - (34%)
Similarity:103/212 - (48%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQE----SSLLFSKITTVSEFYPATHNI 87
            ||:.||:|:||.    :|.:...: ||       |..:|:    :.||   .|.:....|...:.
 Frog    65 GASLGGVSLANG----SLPLGLGF-LC-------GFASQQPPGTTCLL---PTHIPFLQPRADHQ 114

  Fly    88 GSYNTDFHLKSYGDDGLSLTDKS-----------KQRRIRTTFTSNQLNELEKIFLETHYPDIYT 141
            ..:.:|.|.::..||...|.||:           |:||.||.||::||.||||.|.|.||||:|.
 Frog   115 YLHASDKHKENISDDDSLLGDKNDLKASSSQAKRKKRRHRTVFTAHQLEELEKAFNEAHYPDVYA 179

  Fly   142 REEIASKLHLTEARVQVWFQNRRAKFRKQE-------------------RHAIYIMKDKSSKLDG 187
            ||.:|.|..|.|.|:||||||||||:||:|                   ||:|.:   ..|.::.
 Frog   180 REMLALKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPL---PESIINS 241

  Fly   188 RKNPVAGSKYLGPSLKG 204
            .||.:.||  ..|.|.|
 Frog   242 AKNGLVGS--CAPWLLG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
vsx1NP_001093670.1 Homeobox 153..207 CDD:365835 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.