DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and prop1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001170932.2 Gene:prop1 / 100001377 ZFINID:ZDB-GENE-081107-40 Length:227 Species:Danio rerio


Alignment Length:197 Identity:61/197 - (30%)
Similarity:85/197 - (43%) Gaps:56/197 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTD---------KSKQRRIRTTFTSNQLNE 126
            :|::|..|.        ...:...|.:.......|:.|         ...:||.||||::.||..
Zfish    14 YSEVTVSSS--------ADIDVQIHPRKVSQKSESVRDGGARARPYPSPSRRRHRTTFSNEQLEH 70

  Fly   127 LEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER-----HAIYIMKDK----- 181
            ||..|.:.||||||.|||:|....|.|||:||||||||||.|||:|     .|:.:|..:     
Zfish    71 LELAFRQNHYPDIYYREELARVTKLNEARIQVWFQNRRAKQRKQDRITQKSLAVSMMPVRGPLFS 135

  Fly   182 ----SSKLDGRK------------------------NPVAGSKYLGPSLKGPQNGHGRQMKCLYD 218
                ||...||:                        :|.:||::..||...|...: ||....|:
Zfish   136 TMCVSSSAMGRQCQCPHSLPHVPQFSPVLPPGGYPPHPSSGSQFSSPSGSLPSQAN-RQPNDWYN 199

  Fly   219 QI 220
            |:
Zfish   200 QL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 33/51 (65%)
prop1NP_001170932.2 Homeobox 59..112 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.