DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4882 and Mrps27

DIOPT Version :9

Sequence 1:NP_001286791.1 Gene:CG4882 / 37787 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001186121.1 Gene:Mrps27 / 361883 RGDID:1311829 Length:415 Species:Rattus norvegicus


Alignment Length:323 Identity:70/323 - (21%)
Similarity:125/323 - (38%) Gaps:76/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VKQLLDSTNPQETISVLRNPIQYGLFVDQFSGCFLLDFLL-----------------HNGHAVES 131
            ::|.|....|.:.:..|.|.:|||:|.|.|:...|:|:.:                 .....|.|
  Rat   113 IRQCLKYGAPDKALYTLVNKVQYGIFPDNFTFNLLMDYFIKKENYKDALSVVFEIMKQEAFEVPS 177

  Fly   132 AQLATILVDRNLCNNELLESLALQSFWSFAKEFKPFESSQVQPPAK------------------N 178
            .|..::.|        |...||.::..::.:| :.|.:|.:.|..|                  .
  Rat   178 TQFLSLYV--------LYHCLAEKTDLTWEEE-RDFGASLLLPGLKQRNTVGLSSQLYGYALLGK 233

  Fly   179 VEVE--------KVRVKFIRNYPDDASENTEEKKLGRAMVRLGSGEGSLKELKQNVALLGYVLTG 235
            ||::        .:.:.:...|.|.|.:         .|.|:.|....:|..::.:.:|..||  
  Rat   234 VELQCGLRAVYHGMPLIWTPGYLDRALQ---------VMERVASSPEDVKLCREVLDVLDGVL-- 287

  Fly   236 QVPEASSFLASNSAALHKETLLAAQSIVESLKLEGSE-----ELLKSLQEAVEKSSKSNAIQS-- 293
            :|..:....||.:.....|..|.:.::||.|..|..|     :.|:..|.:..|..:.|.::|  
  Rat   288 KVVMSPDGQASETQPQEGEDSLGSANLVEQLDTEEPEQSRLPQYLERFQASRSKLQELNRVESES 352

  Fly   294 ---LLENSVKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEERKATIQKTLSELE 353
               |....||.|:...|.:.||.|.:..:||.::....|||:   |...|:.....::||.:|
  Rat   353 LLTLTTQLVKENLSACEAQDLATYEQKLREWHQERMQLVQRE---QEQREKAKQEYQSLSAVE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 67/318 (21%)
Mrps27NP_001186121.1 MRP-S27 1..406 CDD:287055 67/315 (21%)
PPR repeat 111..135 CDD:276811 5/21 (24%)
PPR repeat 141..171 CDD:276811 3/29 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4570
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D344346at33208
OrthoFinder 1 1.000 - - FOG0007077
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21393
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.