DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TM4SF and Tsp86D

DIOPT Version :9

Sequence 1:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:267 Identity:53/267 - (19%)
Similarity:95/267 - (35%) Gaps:74/267 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CFKYLVYSYVVLLALTGAAQIFLGT-----SLLWGH-----SVYYGIVQNKLWAPAAILLCLGPV 63
            |.||:::....|..|.|...:.:|.     .|:.|:     ...|.::.|    .:.:::..|.:
  Fly    30 CVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFN----ISLVMIIAGVI 90

  Fly    64 TFILCWMGCQATNQRKRCLLGMFAALL---------VACICVQFIICGWSLAMRENLPTSVEIFI 119
            .|.:.:.||....:....||.:::..|         :|.||..|             |..:..|:
  Fly    91 VFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVF-------------PQYMNSFL 142

  Fly   120 DDSFVEFLDKFSRTKVDNLHLWNRM---QSQLQCCGVD--GPLDY-------------RRLSLPW 166
            :   .:|.||...:..|:..|.|.:   |.:..|||:.  |..|:             .|..:|:
  Fly   143 E---YQFTDKIIHSYRDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPY 204

  Fly   167 SCCSRPE-----------------HAYESACDTHYKRGCLAVVSEQIRNRLLITAFGAAIIAIFQ 214
            |||....                 .:..:|....:..||:.:|...:...|.:.|..|..||:.|
  Fly   205 SCCINATDISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQ 269

  Fly   215 SLGIFCA 221
            ...|:.|
  Fly   270 LFVIYLA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 53/267 (20%)
uroplakin_I_like_LEL 111..197 CDD:239409 23/120 (19%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 47/246 (19%)
penumbra_like_LEL 132..255 CDD:239411 24/138 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.