DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ken and bcl11a

DIOPT Version :9

Sequence 1:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001072657.1 Gene:bcl11a / 780114 XenbaseID:XB-GENE-486641 Length:797 Species:Xenopus tropicalis


Alignment Length:522 Identity:111/522 - (21%)
Similarity:169/522 - (32%) Gaps:137/522 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TTDSAYLSSKCGGLRDRADRRKQQY------TSPQNLEPDQTLKY-------------EVDSVDE 168
            |.:..|..:.|.....:|.:.|:..      :||..::.|..|..             ...||.:
 Frog   367 TGEKPYKCNLCDHACTQASKLKRHMKTHIHKSSPMTVKSDDGLSTASSPEPGTSDLLGSASSVLK 431

  Fly   169 SRNAADFSSAFNSN----DNCESAAECERSGGHNNKEEDEDDCTHKDNKSDKDTDEIVNLSNAPP 229
            | ..|.|.|..:||    :..|...|.|.......:||:|:|.|..|::.|              
 Frog   432 S-VVAKFKSENDSNLIPENGDEEEEEEEEEEEEEEEEEEEEDLTETDSRPD-------------- 481

  Fly   230 SGTSGSNSNISTSSNHQQQQHHHHHHHNHNNNNNNNNNNSSSSTINPVNLSLDLRTKSENSASRT 294
                     .|...|.:..:||              .||:.|           :..:|.....::
 Frog   482 ---------YSFGLNLEAARHH--------------ENNARS-----------IEERSMPEVMQS 512

  Fly   295 LGSGSDHSGIDLAVTASESTKRKGLFFDSHKDVMKPLSDGSDINSSPENYV--------VTPHRK 351
            :|.|..|..........|..||..|   |..:|.:...|...:....:...        .:|...
 Frog   513 MGLGMHHFSDAFHQVLMEKHKRGHL---SEPEVQRDTCDEDSVAGESDRIESGTVNGRGCSPGES 574

  Fly   352 RRPGFHNTQSDNQPFTSYPHSLLEELRLAKSTTSPISGFGSEKNMLAHLEDGALNGDTLTPDRKH 416
            ...|.........|.:..|.|  :.::|.|....|.|...:.:|:.:....|             
 Frog   575 ASGGLSKKLLLGSPSSLSPFS--KRIKLEKEFDLPASAMPNTENVYSQWLAG------------- 624

  Fly   417 LLEAQRNRAQSPEIPMHLGPQFVYQWQSNQNAAMSAMPNLQSRLSSLSHISLNLDHPEGR-SGSA 480
              .|...:.:.|         |:....|.|:      |...|...|..:.||....|.|. .|..
 Frog   625 --YAASRQLKEP---------FLTFGDSRQS------PFASSSEHSSENGSLRFSTPPGEMDGGI 672

  Fly   481 SG-SGANLAGSNTHAS-----------SVREYRCEYCGKQFGMSWNLKTHLRVHTGEKPFACRLC 533
            || ||....||..|.|           ..|...||||||.|....||..|.|.||||:|:.|.||
 Frog   673 SGRSGTGSGGSTPHISGPGPGRPSSKEGKRSDTCEYCGKIFKNCSNLTVHRRSHTGERPYKCELC 737

  Fly   534 VAMFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCFESVQELVRHLSGHHNNLLLTKN 598
            .....|.:.|.:|:         .|:|...::.|.|..|.|.|.....|.:|:...|::.:|..:
 Frog   738 NYACAQSSKLTRHM---------KTHGQVGKDVYKCEICQMPFSVYSTLEKHMKKWHSDRVLNND 793

  Fly   599 LR 600
            ::
 Frog   794 IK 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 11/21 (52%)
C2H2 Zn finger 502..522 CDD:275368 11/19 (58%)
zf-H2C2_2 514..539 CDD:290200 12/24 (50%)
C2H2 Zn finger 530..551 CDD:275368 6/20 (30%)
C2H2 Zn finger 569..589 CDD:275368 6/19 (32%)
bcl11aNP_001072657.1 zf-C2H2 345..366 CDD:333835
C2H2 Zn finger 346..366 CDD:275368
zf-H2C2_2 358..383 CDD:372612 3/15 (20%)
C2H2 Zn finger 374..394 CDD:275368 3/19 (16%)
zf-C2H2 705..726 CDD:333835 11/20 (55%)
C2H2 Zn finger 706..726 CDD:275368 11/19 (58%)
zf-H2C2_2 718..743 CDD:372612 12/24 (50%)
C2H2 Zn finger 734..754 CDD:275368 6/28 (21%)
C2H2 Zn finger 764..782 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45993
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.