DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ken and ZNF174

DIOPT Version :9

Sequence 1:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001334797.1 Gene:ZNF174 / 7727 HGNCID:12963 Length:407 Species:Homo sapiens


Alignment Length:329 Identity:84/329 - (25%)
Similarity:125/329 - (37%) Gaps:93/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SHKDVMKPLSDGSDINSSPENYVVTPHRKRRPGFHNTQS--------DNQPFTSYPHSLLEELRL 379
            |.|:::..:.|....:..|:.:|....:.::.....|.|        |.||.|  |...|.|   
Human   113 SSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQT--PRRDLRE--- 172

  Fly   380 AKSTTSPISGFGSEKNMLAHLEDGALNGDTLTP---DRKHLL----------EAQRNRAQSPEIP 431
                :||     :|.:     :.||.  |.|:|   ::..||          ||.|.|:.:.|.|
Human   173 ----SSP-----AEPS-----QAGAY--DRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENP 221

  Fly   432 MHLG-----PQFVYQWQSNQN---------AAMS---------AMPNLQ------SRLSSLSHIS 467
            ...|     |..|...:|..|         |.||         :.||.|      .|...:.:||
Human   222 QQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHCRVEYIS 286

  Fly   468 LNL-DHPEGRSGSASGSGANLAGSNTH------ASSVREYRCEYCGKQFGMSWN--LKTHLRVHT 523
            ..| .||......:.|...:|:....|      .|:.:.|:|:.|||.|  :||  ||.|.||||
Human   287 SPLKSHPLRELKKSKGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSF--TWNSELKRHKRVHT 349

  Fly   524 GEKPFACRLCVAMFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCFESVQELVRHLSG 588
            ||:|:.|..|...|.:::.|     .:|:.:.|      .|..|.|..|...|.....|.:|...
Human   350 GERPYTCGECGNCFGRQSTL-----KLHQRIHT------GEKPYQCGQCGKSFRQSSNLHQHHRL 403

  Fly   589 HHNN 592
            ||.:
Human   404 HHGD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 12/23 (52%)
C2H2 Zn finger 502..522 CDD:275368 11/21 (52%)
zf-H2C2_2 514..539 CDD:290200 14/26 (54%)
C2H2 Zn finger 530..551 CDD:275368 4/20 (20%)
C2H2 Zn finger 569..589 CDD:275368 5/19 (26%)
ZNF174NP_001334797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..270 34/140 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4872
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.