DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ken and bcl11aa

DIOPT Version :9

Sequence 1:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001035481.1 Gene:bcl11aa / 678650 ZFINID:ZDB-GENE-060421-4643 Length:829 Species:Danio rerio


Alignment Length:524 Identity:117/524 - (22%)
Similarity:189/524 - (36%) Gaps:121/524 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TTDSAYLSSKCGGLRDRADRRKQQYTSPQNLEPDQTLKYE-------------VDSVDESRNA-- 172
            |.:..|....|.....:|.:.|:...:..|.....|:|.:             .|.|..:.||  
Zfish   379 TGEKPYKCHLCDHACTQASKLKRHMKTHMNKSSPTTVKSDDGLSTASSPEPGTSDLVGSASNALK 443

  Fly   173 ---ADFSSAFNSNDNCESAAECERSGGHNNKEEDEDDCTHKDNKSDKDTDEIVNLSNAPPSGTSG 234
               |.|.|            |.:|....|.:||:|::...::.:.:::.:|            .|
Zfish   444 SVVAKFKS------------ENDRMIPENGEEEEEEEEEEEEEEEEEEEEE------------EG 484

  Fly   235 SNSNISTSSNHQQQQHHHHHHHNHNNNNNNNNNNSSSSTINPVNLSLDLRTKSENSASRTLGSGS 299
            ....:     .::::.........:.:...||.:.|        |:|......||:..|.   |.
Zfish   485 EEEEL-----ERERERERERERERDRDGGRNNYHFS--------LNLQAARHHENNGGRL---GE 533

  Fly   300 DHSGIDLAVTASESTKRKGLFFDSHKDVMKPLSDGSDINSSPENYVVTPHRKRRPGFHNTQSDNQ 364
            |  ||..::                .:||:    |..:.:|.::|....|:.:| |..|:.:|..
Zfish   534 D--GIPRSL----------------PEVMQ----GMGLAASMQHYSEAFHQHKR-GALNSDNDAH 575

  Fly   365 PFTSYPHSLLEELRLAKSTTSPISGFGSEKNMLAH--LEDGALNG--DTLTPDRKHLLEAQRNRA 425
            .......|.||..|:.:...|.|:|.||..:..|.  |....|.|  .:|:|..|.:...:....
Zfish   576 RDMCDEDSALESDRVDEGCGSAINGRGSSPSESASVGLSKKLLLGSPSSLSPFSKRIKLEKDFDL 640

  Fly   426 QSPEIPMHLGPQFVY-QWQSNQNAAMS------------AMPNLQSRLSSLSHISLNLDHP---- 473
            .:|.||   ..:.|| ||.:...|:..            ..|...|...|..:.||....|    
Zfish   641 STPTIP---NTENVYSQWLAGYAASRQLKDPFLNFGDSRQSPFASSSEHSSENGSLRFSTPPGDL 702

  Fly   474 ----EGRSGSASGSGANLAGSNTHASSV---REYRCEYCGKQFGMSWNLKTHLRVHTGEKPFACR 531
                .||||:.||......|.....||.   |...||:|||.|....||..|.|.||||:|:.|.
Zfish   703 DGGVSGRSGTGSGGSTPHLGGPGRPSSKDGRRTDTCEFCGKVFKNCSNLTVHRRSHTGERPYKCE 767

  Fly   532 LCVAMFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCFESVQELVRHLSGHHNNLLLT 596
            ||.....|.:.|.:|:         .|:|...::.|.|..|.|.|.....|.:|:...|::..|:
Zfish   768 LCNYACAQSSKLTRHM---------KTHGQVGKDVYKCEICQMPFSVYSTLEKHMKKWHSDRPLS 823

  Fly   597 KNLR 600
            ..::
Zfish   824 TEIK 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 10/21 (48%)
C2H2 Zn finger 502..522 CDD:275368 10/19 (53%)
zf-H2C2_2 514..539 CDD:290200 12/24 (50%)
C2H2 Zn finger 530..551 CDD:275368 6/20 (30%)
C2H2 Zn finger 569..589 CDD:275368 6/19 (32%)
bcl11aaNP_001035481.1 COG5048 326..>411 CDD:227381 6/31 (19%)
zf-C2H2 357..378 CDD:278523
C2H2 Zn finger 358..378 CDD:275368
zf-H2C2_2 370..395 CDD:290200 3/15 (20%)
C2H2 Zn finger 386..406 CDD:275368 3/19 (16%)
zf-C2H2 737..758 CDD:278523 10/20 (50%)
C2H2 Zn finger 738..758 CDD:275368 10/19 (53%)
zf-H2C2_2 750..775 CDD:290200 12/24 (50%)
C2H2 Zn finger 766..786 CDD:275368 6/28 (21%)
C2H2 Zn finger 796..814 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45993
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.