DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ken and Bcl11b

DIOPT Version :9

Sequence 1:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_011242454.1 Gene:Bcl11b / 58208 MGIID:1929913 Length:928 Species:Mus musculus


Alignment Length:479 Identity:105/479 - (21%)
Similarity:159/479 - (33%) Gaps:127/479 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CESAAECERSGGHNNKEEDEDDCTHKDNKSDKDTDEIVNLSNAPPSGTSGSNSNISTSSNHQQQQ 249
            |..|::.:|   |....      .||.......:|:.::.:::|..|||....::..:..     
Mouse   507 CSQASKLKR---HMKTH------MHKAGSLAGRSDDGLSAASSPEPGTSELPGDLKAADG----- 557

  Fly   250 HHHHHHHNHNNNNNNNNNNSSSSTINPVNLSLDLRTKSENSASRTLGSGSDH----------SGI 304
            ...||..:.:......::.........:.|..:.|.:|..|....||.|.::          :|.
Mouse   558 DFRHHESDPSLGPEPEDDEDEEEEEEELLLENESRPESSFSMDSELGRGRENGGGVPPGVAGAGA 622

  Fly   305 DLAVTASEST-------------------KRKGLFFDSHKDVMKPLSDGSDINSSPENYVVTPHR 350
            ..|..|.|..                   :::|.|       :|...|..|..:      |....
Mouse   623 AAAALADEKALALGKVMEDAGLGALPQYGEKRGAF-------LKRAGDTGDAGA------VGCGD 674

  Fly   351 KRRPGFHNTQS-----DNQPFTS-YPHSLLEELRLAKSTTSPISGFGSEKNMLAHLEDGALNGDT 409
            ...||..|.:.     ..:||.: :|.         |....|..|.|               |..
Mouse   675 AGAPGAVNGRGGAFAPGAEPFPALFPR---------KPAPLPSPGLG---------------GPA 715

  Fly   410 LTPDRKHLLEAQRNRAQSPEIPMHLGPQFVY-QWQSNQNAAMSAM-------------PNLQSRL 460
            |...::..:|.......:..||    .:.|| ||.....|:...|             |...|..
Mouse   716 LHAAKRIKVEKDLELPPAALIP----SENVYSQWLVGYAASRHFMKDPFLGFTDARQSPFATSSE 776

  Fly   461 SSLSHISLNLDHP---------EGRSGSAS-GSGANLAGSNTHASSVREYR----CEYCGKQFGM 511
            .|..:.||....|         .||||:|| ||..:|.|......|.:|.|    ||||||.|..
Mouse   777 HSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVFKN 841

  Fly   512 SWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCF 576
            ..||..|.|.||||:|:.|.||.....|.:.|.:|:         .|:|...:..|.|..|.|.|
Mouse   842 CSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHM---------KTHGQIGKEVYRCDICQMPF 897

  Fly   577 ESVQELVRHLSGHHNNLLLTKNLR 600
            .....|.:|:...|...|||.:::
Mouse   898 SVYSTLEKHMKKWHGEHLLTNDVK 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 12/25 (48%)
C2H2 Zn finger 502..522 CDD:275368 11/19 (58%)
zf-H2C2_2 514..539 CDD:290200 12/24 (50%)
C2H2 Zn finger 530..551 CDD:275368 6/20 (30%)
C2H2 Zn finger 569..589 CDD:275368 6/19 (32%)
Bcl11bXP_011242454.1 zf-C2H2 471..492 CDD:333835
C2H2 Zn finger 472..492 CDD:275370
zf-H2C2_2 484..509 CDD:372612 1/1 (100%)
C2H2 Zn finger 500..520 CDD:275370 4/15 (27%)
zf-C2H2 831..852 CDD:333835 11/20 (55%)
C2H2 Zn finger 832..852 CDD:275368 11/19 (58%)
zf-H2C2_2 844..869 CDD:372612 12/24 (50%)
C2H2 Zn finger 860..880 CDD:275368 6/28 (21%)
C2H2 Zn finger 890..908 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45993
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.