DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ken and Bcl11a

DIOPT Version :9

Sequence 1:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001178612.1 Gene:Bcl11a / 305589 RGDID:1309923 Length:835 Species:Rattus norvegicus


Alignment Length:520 Identity:113/520 - (21%)
Similarity:177/520 - (34%) Gaps:146/520 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QTLKYEVDSVDESR----------NAADFSSAFNSNDNCESAAECERSGGHNNKEEDEDDCTHKD 211
            :|.|::.:.|...|          |..|.:        |..|::.:|   |....      .||.
  Rat   384 KTFKFQSNLVVHRRSHTGEKPYKCNLCDHA--------CTQASKLKR---HMKTH------MHKS 431

  Fly   212 NKSDKDTDEIVNLSNAPPSGTS---GSNSNISTS---------------SNHQQQQHHHHHHHNH 258
            :.....:|:.::.:::|..|||   ||.|:...|               .|..:::.........
  Rat   432 SPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEEDDEEEEE 496

  Fly   259 NNNNNNNNNNSSSSTINPVNLSLDLRTKSENSA-SRTLGSGSDHSGIDLAVTASESTKRKGLFFD 322
            ...........|........|||:.....|||: ...:|.|.:...:                  
  Rat   497 EEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDEGRAL------------------ 543

  Fly   323 SHKDVMKPLSDGSDINSSPENYVVTPHRKRRPGFHNTQSDNQPFTSYPHSLLEELRLAKSTTSPI 387
              .|||:.:     :.||.:::        ...||....:     .:..|.|.|....:.|....
  Rat   544 --PDVMQGM-----VLSSMQHF--------SEAFHQVLGE-----KHKRSHLAEAEGHRDTCDED 588

  Fly   388 SGFGSEKNMLAHLEDGALNGDTLTP--------DRKHLLEAQRNRAQSP-----------EIPMH 433
            |..|...    .::||.:||...:|        .:|.||.:.  .:.||           ::|..
  Rat   589 SVAGESD----RIDDGTVNGRGCSPGESASGGLSKKLLLGSP--SSLSPFSKRIKLEKEFDLPPA 647

  Fly   434 LGP--QFVY-QWQSNQNAAMS------------AMPNLQSRLSSLSHISLNLDHPEGR-SGSASG 482
            ..|  :.|| ||.:...|:..            ..|...|...|..:.||....|.|. .|..||
  Rat   648 AMPNTENVYSQWLAGYAASRQLKDPFLTFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISG 712

  Fly   483 -SGANLAGSNTHAS-------SVREYR----CEYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVA 535
             ||....||..|.|       |.:|.|    ||||||.|....||..|.|.||||:|:.|.||..
  Rat   713 RSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNY 777

  Fly   536 MFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCFESVQELVRHLSGHHNNLLLTKNLR 600
            ...|.:.|.:|:         .|:|...::.|.|..|.|.|.....|.:|:...|::.:|..:::
  Rat   778 ACAQSSKLTRHM---------KTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIK 833

  Fly   601  600
              Rat   834  833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 12/25 (48%)
C2H2 Zn finger 502..522 CDD:275368 11/19 (58%)
zf-H2C2_2 514..539 CDD:290200 12/24 (50%)
C2H2 Zn finger 530..551 CDD:275368 6/20 (30%)
C2H2 Zn finger 569..589 CDD:275368 6/19 (32%)
Bcl11aNP_001178612.1 zf-C2H2 378..399 CDD:395048 4/14 (29%)
C2H2 Zn finger 379..399 CDD:275368 4/14 (29%)
zf-H2C2_2 391..416 CDD:404364 5/32 (16%)
C2H2 Zn finger 407..427 CDD:275368 6/30 (20%)
zf-C2H2 743..764 CDD:395048 11/20 (55%)
C2H2 Zn finger 744..764 CDD:275368 11/19 (58%)
zf-H2C2_2 756..781 CDD:404364 12/24 (50%)
C2H2 Zn finger 772..792 CDD:275368 6/28 (21%)
C2H2 Zn finger 802..820 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45993
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.