| Sequence 1: | NP_523833.1 | Gene: | ken / 37785 | FlyBaseID: | FBgn0011236 | Length: | 601 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_660331.1 | Gene: | ZNF296 / 162979 | HGNCID: | 15981 | Length: | 475 | Species: | Homo sapiens |
| Alignment Length: | 256 | Identity: | 62/256 - (24%) |
|---|---|---|---|
| Similarity: | 94/256 - (36%) | Gaps: | 62/256 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 381 KSTTSPI--SGFGSEKNMLAHLEDGALNGDTLTPDRKHLL-EAQRNRAQSPEIPMH------LGP 436
Fly 437 QFVYQWQSNQNAAMSAMPNLQSRLSSLSHISLNLDHPEGRSGSAS---------GSGANLA-GSN 491
Fly 492 THASSVREYR---------------------------CEYCGKQFGMSWNLKTHLRVHTGEKPFA 529
Fly 530 CRLCVAMFKQKAHLLKHLCSVHRNVITTTNGADTENRYSCCFCSMCFESVQELVRHLSGHH 590 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ken | NP_523833.1 | BTB | 27..>107 | CDD:279045 | |
| BTB | 34..>107 | CDD:197585 | |||
| zf-C2H2 | 500..522 | CDD:278523 | 12/48 (25%) | ||
| C2H2 Zn finger | 502..522 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 514..539 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 530..551 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 569..589 | CDD:275368 | 6/19 (32%) | ||
| ZNF296 | NP_660331.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..78 | ||
| zf-C2H2 | 232..253 | CDD:306579 | 5/27 (19%) | ||
| C2H2 Zn finger | 233..253 | CDD:275370 | 4/26 (15%) | ||
| zf-H2C2_2 | 245..270 | CDD:316026 | 4/31 (13%) | ||
| C2H2 Zn finger | 261..281 | CDD:275370 | 4/19 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 275..385 | 19/110 (17%) | |||
| zf-C2H2_2 | 387..>467 | CDD:315435 | 31/87 (36%) | ||
| zf-C2H2 | 387..408 | CDD:306579 | 11/20 (55%) | ||
| C2H2 Zn finger | 388..408 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 400..425 | CDD:316026 | 11/24 (46%) | ||
| C2H2 Zn finger | 416..436 | CDD:275368 | 6/24 (25%) | ||
| C2H2 Zn finger | 447..465 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45993 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||