DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpbeta and CG17597

DIOPT Version :9

Sequence 1:NP_477378.1 Gene:Mtpbeta / 37784 FlyBaseID:FBgn0025352 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001286066.1 Gene:CG17597 / 35140 FlyBaseID:FBgn0032715 Length:407 Species:Drosophila melanogaster


Alignment Length:468 Identity:93/468 - (19%)
Similarity:161/468 - (34%) Gaps:117/468 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VLVDGV-RTPFLTSGTTYSKLMPHELARHSLLSLLQKNRLDKELIDYIVYGSVIQEVKTSNIARE 108
            |.|.|| .|.|...|.......| :.|:.::...||...:..|.:...|.|.|..:   |...:.
  Fly     6 VYVIGVGMTKFEKPGRRADACYP-DFAKEAITKALQDAGIKFEEVQQAVAGYVYGD---STCGQR 66

  Fly   109 AALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEFMSDVPIRHSRKMRSLL 173
            |....|.:. .|.:.|...|.:.::|:.....::.:...:.::|.|.|           ||....
  Fly    67 AIYEVGMTG-IPVYNVNNNCSTGSSALYLAKQIVESGNSECVLALGFE-----------KMERGS 119

  Fly   174 LKA---NKAKTLGQRLALLSTFRPDFLAPELPAVAEFSSGETMGHSADRLASAF-NVSRSEQDEY 234
            |.|   ::|..:.:.:.            |:..:.|..:|       ...|..| |..:....:|
  Fly   120 LSAKYFDRANPMERHIT------------EMSELTEIGAG-------PMAAQIFGNAGKEHMKKY 165

  Fly   235 ALRSHTLAKEAQEKGYFTDLVPFKVSGVDQIVDKDNGIRVSSP----------ESLAKLRPAFVK 289
            ..:.....|                     |..|::...|::|          |.:.| .|..|:
  Fly   166 GTKPEHFGK---------------------IAWKNHKHSVNNPYSQFRDEYTLEQIMK-SPQVVE 208

  Fly   290 PYGTVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDFLFVSQDPVNQL-------LLG-- 345
              |.:|.......:||:.|.|:.:|...::.||:.:|.....:.::.||.:..       :.|  
  Fly   209 --GVLTKLQCCPTSDGSGAAILASEAFVRRHGLEKQAVEIVGMEMASDPASTFADKSLMKIAGTD 271

  Fly   346 -PAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFC-------------KTYLGL 396
             ......:|..|:|...:|:...|:|:.|:...:...:||.   .|             .||.| 
  Fly   272 MTRLATERLFAKSGYKPQDVQVVELHDCFSANELITYEALG---LCGEGKAGEFIDAGDNTYGG- 332

  Fly   397 NEKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMH-------TANRLVREDGKLGVVAACAAGGQ 454
             :.|..|.       ||.:|.|||..|||:..|..       .|.:....:.:|.:......||.
  Fly   333 -KFVVNPS-------GGLISKGHPLGATGLAQCAELCWQLRGLAEKRQVPNAQLALQHNLGLGGA 389

  Fly   455 GVAMLIE-RYPGA 466
            .|..|.. .:|||
  Fly   390 VVVALYRLGFPGA 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpbetaNP_477378.1 fadI 44..462 CDD:181597 90/462 (19%)
thiolase 45..462 CDD:238383 90/462 (19%)
CG17597NP_001286066.1 PRK08256 5..396 CDD:181327 90/460 (20%)
SCP-x_thiolase 9..395 CDD:238425 87/456 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.