DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpbeta and LOC103910030

DIOPT Version :9

Sequence 1:NP_477378.1 Gene:Mtpbeta / 37784 FlyBaseID:FBgn0025352 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009296692.3 Gene:LOC103910030 / 103910030 -ID:- Length:295 Species:Danio rerio


Alignment Length:253 Identity:94/253 - (37%)
Similarity:142/253 - (56%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MGHSADRLASAFNVSRSEQDEYALRSHTLAKEAQEKGYFT-DLVPFKV---SGVDQIVDKDNGIR 273
            ||.:|:.||..:.:||.|.|:|:.::....|.|.|.|||: ::.|.:|   .|...:...::...
Zfish    59 MGITAENLAEKYQISREECDQYSHQTQQRWKAAHEAGYFSAEIAPIEVKAKKGKVSMTFDEHPRP 123

  Fly   274 VSSPESLAKLRPAFVKPYGTVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDFLFVSQDP 338
            .::.|.:||| |...|..|||||||||.::|||:|.||.:|:..|...|.|.|.:..:.....||
Zfish   124 QTTLEQMAKL-PTVFKKGGTVTAANASGVSDGAAAVIIASEDAVKAHKLTPLARIVSYHTSGCDP 187

  Fly   339 VNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCKTYLGLNEKVGTP 403
             :.:.:||...|.:.||||||::||:|..|::||||.|                ||.:.:.:|. 
Zfish   188 -SIMGIGPVPAITEALKKAGLSIKDMDLVEVNEAFAPQ----------------YLSVAKSLGL- 234

  Fly   404 DLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAAGGQGVAMLIE 461
            |..|.|..||:::||||..|:|.|:..|..:.|.|..||..|.:||..||||:|:::|
Zfish   235 DPEKTNVNGGAIAIGHPLGASGTRITAHLVHELRRRGGKYAVGSACIGGGQGIAVILE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpbetaNP_477378.1 fadI 44..462 CDD:181597 94/253 (37%)
thiolase 45..462 CDD:238383 94/253 (37%)
LOC103910030XP_009296692.3 thiolase <40..293 CDD:238383 94/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.