DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5569 and Ndufaf3

DIOPT Version :10

Sequence 1:NP_611840.1 Gene:CG5569 / 37783 FlyBaseID:FBgn0034919 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_064465.1 Gene:Ndufaf3 / 56769 RGDID:708545 Length:185 Species:Rattus norvegicus


Alignment Length:130 Identity:49/130 - (37%)
Similarity:82/130 - (63%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KTKVTIFNTETDLGLMVTGYSQYGFRLNNDMVLIGPISVFPRSVLSWNVNSFEDINEDSLSLFPT 107
            :|::::...|....:.:..|:..||.:|.:.| .||.::.|::|:.|||.|.:||.|:|.|:|..
  Rat    45 RTRISLLQNEFPQAVYIDSYNSRGFTINGNRV-FGPCALLPQTVVQWNVGSHQDITEESFSIFWM 108

  Fly   108 LEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQACATFNFLNAENRMVACALIPP 172
            |||:|:::::|.|::.  ..|..::::.|::..|.|||..|..||||||||..|.|:...|||||
  Rat   109 LEPRIEIVVVGTGNKT--ERLHSQVLQAMRQRGIAVEIQDTPNACATFNFLCHEGRVTGAALIPP 171

  Fly   173  172
              Rat   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5569NP_611840.1 Mth938_2P1-like 57..172 CDD:240161 45/114 (39%)
Ndufaf3NP_064465.1 Mth938_2P1-like 59..172 CDD:240161 47/116 (41%)

Return to query results.
Submit another query.