DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5569 and AAMDC

DIOPT Version :10

Sequence 1:NP_611840.1 Gene:CG5569 / 37783 FlyBaseID:FBgn0034919 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_047282792.1 Gene:AAMDC / 28971 HGNCID:30205 Length:187 Species:Homo sapiens


Alignment Length:66 Identity:20/66 - (30%)
Similarity:35/66 - (53%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DINEDSLSLFPTLEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQACATFNFLNA 160
            |:.|       .:|..:..|:||.| .:....:....:|::||:.|:|.:|:||||...:|.|.|
Human   118 DVKE-------VVEKGVQTLVIGRG-MSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVA 174

  Fly   161 E 161
            :
Human   175 Q 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5569NP_611840.1 Mth938_2P1-like 57..172 CDD:240161 20/66 (30%)
AAMDCXP_047282792.1 Mth938 24..185 CDD:240162 20/66 (30%)

Return to query results.
Submit another query.