DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and ZCRB1

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens


Alignment Length:156 Identity:39/156 - (25%)
Similarity:52/156 - (33%) Gaps:49/156 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRW 175
            |..||:..|...|...|..||:|:...|.||..:.:|||..|:.|...|:...            
Human    14 VSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQN------------ 66

  Fly   176 CEVKVPNSKGMGHQVPCKVFV--GRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDP 238
            |...:.|.:..|..:...:.:  ||..|.|..   |.||.|                        
Human    67 CTRAINNKQLFGRVIKASIAIDNGRAAEFIRR---RNYFDK------------------------ 104

  Fly   239 DVAQSLCGEDHIIKGVSVHVSNAAPK 264
                |.|.|    .|.|.|:|.|.||
Human   105 ----SKCYE----CGESGHLSYACPK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 19/69 (28%)
RRM2_TDP43 192..261 CDD:409761 15/70 (21%)
ZCRB1NP_149105.3 RRM_ZCRB1 9..84 CDD:409827 21/81 (26%)
PTZ00368 <97..123 CDD:173561 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.