DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and YRA1

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_010669.1 Gene:YRA1 / 851988 SGDID:S000002789 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:40/208 - (19%)
Similarity:76/208 - (36%) Gaps:46/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSK 148
            ||:.....|:.|:..::....|...:.|.|||....::::||:|.:....:...:....:.|||.
Yeast    55 RKNTRAPPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQST 119

  Fly   149 GFGFVRFGSYDAQMRVLT--NRHLIDGRWCEVKV-----PNSKGMGHQVPCKVFVGRCTEDINSD 206
            |...:.|.:.:...|.:.  |...|||....:::     ||      |.|.|..         :|
Yeast   120 GMANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPN------QRPVKSL---------AD 169

  Fly   207 DLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQ 271
            .::....|.|..     |||.:.       .|:            :..::..|...||.|:...:
Yeast   170 RIKAMPQKGGNA-----PRPVKR-------GPN------------RKAAMAKSQNKPKREKPAKK 210

  Fly   272 QVQSYNYNSANSF 284
            .::..:...|:.|
Yeast   211 SLEDLDKEMADYF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 17/79 (22%)
RRM2_TDP43 192..261 CDD:409761 9/68 (13%)
YRA1NP_010669.1 RRM_YRA1_MLO3 78..156 CDD:409711 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.