DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and SC35

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:101 Identity:31/101 - (30%)
Similarity:52/101 - (51%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL--TNRHLI 171
            |:||.:.::||.:.|...|..||:|:...|.:|.::|.|:||.|||:...|...:.:  .:..::
plant    18 LLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVV 82

  Fly   172 DGRWCEVKV------PNSKGMGHQVPCKVFVGRCTE 201
            |||  |:.|      ||::        |:..||..|
plant    83 DGR--EITVQFAKYGPNAE--------KISKGRVVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 25/79 (32%)
RRM2_TDP43 192..261 CDD:409761 4/10 (40%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 24/73 (33%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.