DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT5G59860

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_200794.1 Gene:AT5G59860 / 836108 AraportID:AT5G59860 Length:157 Species:Arabidopsis thaliana


Alignment Length:114 Identity:34/114 - (29%)
Similarity:55/114 - (48%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FPKENKRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDT 142
            |.|..|.|......:|.:|.:|:......|.:...||...||::|||:.|..:     |::.||.
plant    42 FNKRTKYKMRIRPRSSISKRRRLIGGKTLTCVSNSGLSAYTTDQSLRQLFAPF-----ARLIKDQ 101

  Fly   143 KSGQSKGFGFVRFGSYDAQMRVL--TNRHLIDGRWC------EVKVPNS 183
            ::.:.|||||:.|.|.|...:.|  .|..:::||..      ||:.|.:
plant   102 QTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAKEVEAPTT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 34/114 (30%)
RRM1_TDP43 108..181 CDD:409760 25/80 (31%)
RRM2_TDP43 192..261 CDD:409761
AT5G59860NP_200794.1 RRM 73..144 CDD:440488 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.