DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT5G54580

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_200269.1 Gene:AT5G54580 / 835546 AraportID:AT5G54580 Length:156 Species:Arabidopsis thaliana


Alignment Length:90 Identity:32/90 - (35%)
Similarity:46/90 - (51%) Gaps:10/90 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLI 171
            |:|.|.||..:||.|.||..|..:|||..|::..|..||.||||||||:.:.:...:.:..   :
plant    56 TNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAG---M 117

  Fly   172 DGR----W---CEVKVPNSKGMGHQ 189
            ||:    |   .|...|..:...:|
plant   118 DGKFLDGWVIFAEYARPREQSQSYQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 29/79 (37%)
RRM2_TDP43 192..261 CDD:409761
AT5G54580NP_200269.1 RRM 55..138 CDD:440488 31/84 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.